PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0807s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 153aa    MW: 17472.6 Da    PI: 4.8898
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0807s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.39e-16711461796
                          E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                           +p +f++e++++  ++ +++l++e+  sW+v++    + g+y l +GW+ F  +ng++ gD++ Fkl++  + e++v+v
  Kaladp0807s0003.1.p  71 NIPMQFIRENSLSYLTDEKMVLRTETRSSWSVNI--VANTGGYKLCGGWSAFLIDNGINKGDICEFKLMS--RLEMWVQV 146
                          69********888888999***************..99999**************************986..67778887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010193.5E-449150IPR003340B3 DNA binding domain
CDDcd100177.93E-1350146No hitNo description
Gene3DG3DSA:2.40.330.103.1E-1571146IPR015300DNA-binding pseudobarrel domain
PfamPF023625.3E-1471146IPR003340B3 DNA binding domain
SuperFamilySSF1019365.1E-1571147IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.03972150IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MELGSDAESR SEGWQEEEGA KQLEVLETGQ VDEQVSRRGY EDTLGSREKM RQMQDSHRST  60
RNQIYADIAK NIPMQFIREN SLSYLTDEKM VLRTETRSSW SVNIVANTGG YKLCGGWSAF  120
LIDNGINKGD ICEFKLMSRL EMWVQVTPNR PR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.14e-08B3 family protein